RetrogeneDB ID: | retro_pabe_996 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 13:45623029..45623270(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX4I1 | ||
| Ensembl ID: | ENSPPYG00000007619 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit 4 isoform 1, mitochondrial [Source:RefSeq peptide;Acc:NP_001126477] |
| Percent Identity: | 65.06 % |
| Parental protein coverage: | 70.69 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | LSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALIIMWQKRH |
| LSAS...LKEKEKASWS.LSMDEKVEL..I.F..SF...NRG...WK.VV..AMFF.GFTAL...W.K.H | |
| Retrocopy | LSASKEDLKEKEKASWSNLSMDEKVELCCIQFNRSFSGINRGMKKWKMVVSTAMFF-GFTALVLIW-KKH |
| Parental | -VYGPLPQSFDKE |
| .VYG..P.SFD.E | |
| Retrocopy | >VYGLIPHSFDEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 31 .02 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 28 .45 RPM |
| SRP007412_heart | 0 .00 RPM | 53 .10 RPM |
| SRP007412_kidney | 0 .00 RPM | 40 .11 RPM |
| SRP007412_liver | 0 .00 RPM | 26 .32 RPM |