RetrogeneDB ID: | retro_pabe_3310 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 8:30197244..30197661(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TAGLN2 | ||
| Ensembl ID: | ENSPPYG00000000648 | ||
| Aliases: | None | ||
| Description: | transgelin 2 [Source:HGNC Symbol;Acc:11554] |
| Percent Identity: | 76.26 % |
| Parental protein coverage: | 69.85 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | QWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINALYPEGQAPVKKIQASTMAFKQMEQISQFLQAAE |
| QWITTQC.KDVG.PQ.G.ENFQN.LK.GT.LCELINAL.P.GQAPVKK.QASTMA.KQMEQISQ.LQAAE | |
| Retrocopy | QWITTQCQKDVGWPQLGHENFQNFLKEGTELCELINALCPKGQAPVKKTQASTMALKQMEQISQCLQAAE |
| Parental | RYGINTTDIFQTVDLWEGKNMACVQRTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPRNFSDNQLQEG |
| .YGINTTDIFQTV..W.GKN.ACV...LMNLGGL.VA.DDGLFSG.P.WFPKK.KE.P.NFS......G | |
| Retrocopy | HYGINTTDIFQTVHPWGGKNVACVRWILMNLGGLVVAQDDGLFSGAPIWFPKKPKETPWNFSTSYKRAG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 39 .75 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 17 .27 RPM |
| SRP007412_heart | 0 .00 RPM | 57 .05 RPM |
| SRP007412_kidney | 0 .00 RPM | 115 .19 RPM |
| SRP007412_liver | 0 .03 RPM | 94 .59 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Macaca mulatta | retro_mmul_2328 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002068 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000006156 | 2 retrocopies | |
| Homo sapiens | ENSG00000158710 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006573 | 9 retrocopies | |
| Myotis lucifugus | ENSMLUG00000026228 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004705 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000010032 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013350 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000000648 | 2 retrocopies |
retro_pabe_3310 , retro_pabe_3364,
|
| Pongo abelii | ENSPPYG00000009302 | 12 retrocopies | |
| Pan troglodytes | ENSPTRG00000001533 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000006395 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000001645 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001814 | 1 retrocopy |