RetrogeneDB ID: | retro_pabe_2126 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 2b:67418667..67418879(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DNAJC19 | ||
| Ensembl ID: | ENSPPYG00000014328 | ||
| Aliases: | DNAJC19, TIM14, TIMM14 | ||
| Description: | Mitochondrial import inner membrane translocase subunit TIM14 [Source:UniProtKB/Swiss-Prot;Acc:Q5RF34] |
| Percent Identity: | 73.97 % |
| Parental protein coverage: | 62.07 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | VLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRI-MLLNH |
| .LQA.KH..P.VKQ.FQSLPKSAFSGGY.R.GFEPKMTK.EAA.IL.VS.TA.KGKIRDA...I.M.LNH | |
| Retrocopy | ILQARKHT*PEVKQDFQSLPKSAFSGGY*RSGFEPKMTKWEAA-ILPVSLTASKGKIRDAQ*QI<MILNH |
| Parental | PDK |
| P.K | |
| Retrocopy | PKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 8 .79 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 7 .17 RPM |
| SRP007412_heart | 0 .00 RPM | 17 .76 RPM |
| SRP007412_kidney | 0 .10 RPM | 15 .35 RPM |
| SRP007412_liver | 0 .00 RPM | 15 .52 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2349 |
| Pan troglodytes | retro_ptro_1719 |
| Gorilla gorilla | retro_ggor_1783 |
| Macaca mulatta | retro_mmul_946 |