RetrogeneDB ID: | retro_mmus_3233 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 8:109973952..109974353(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rps24 | ||
| Ensembl ID: | ENSMUSG00000025290 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S24 [Source:MGI Symbol;Acc:MGI:98147] |
| Percent Identity: | 79.26 % |
| Parental protein coverage: | 97.74 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGK-TTGF |
| .VTI.TRKFMTNRLLQR..MV.DVLHPGKAT.PKTEIREKLA.MYKT.PDVIFVF.FRTHFGGGK.TTGF | |
| Retrocopy | SVTIQTRKFMTNRLLQRTEMVTDVLHPGKATAPKTEIREKLANMYKTSPDVIFVFRFRTHFGGGKTTTGF |
| Parental | GMIYDSLDYAKKNEPKHRLARH--GLYEKKK-TSRKQRKERKNRMKKVR-GTAKANVGAGKKPKE |
| GMI.DSLDY.KKNEP.HRL.RH.......KK.TS.KQRK..K.RMKKVR.GTAKANVG.GKKPKE | |
| Retrocopy | GMICDSLDYTKKNEPTHRLTRHSASMRRRKK>TSPKQRKGHKIRMKKVR>GTAKANVGPGKKPKE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 95 .09 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 56 .45 RPM |
| SRP007412_heart | 0 .00 RPM | 84 .33 RPM |
| SRP007412_kidney | 0 .00 RPM | 81 .08 RPM |
| SRP007412_liver | 0 .00 RPM | 94 .84 RPM |
| SRP007412_testis | 0 .00 RPM | 102 .82 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017818 | 17 retrocopies | |
| Cavia porcellus | ENSCPOG00000020096 | 3 retrocopies | |
| Dipodomys ordii | ENSDORG00000000189 | 4 retrocopies | |
| Felis catus | ENSFCAG00000000849 | 3 retrocopies | |
| Gadus morhua | ENSGMOG00000012595 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000027878 | 10 retrocopies | |
| Myotis lucifugus | ENSMLUG00000024102 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000003778 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000025290 | 13 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000012472 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000011005 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000002304 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000010189 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000010328 | 8 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000013000 | 4 retrocopies |