RetrogeneDB ID: | retro_cpor_1333 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_7:18044151..18044495(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS24 | ||
| Ensembl ID: | ENSCPOG00000020096 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S24 [Source:HGNC Symbol;Acc:10411] |
| Percent Identity: | 59.48 % |
| Parental protein coverage: | 85.07 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | TIRTRKFMTNR-LLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTT-PDVIFVFGFRTHFGGGKTTGFG |
| T..TRK...NR..L..K.M.IDVLHPGKA.VP..EI.EK......TT..D..FVFG.RTHFGGGK..GFG | |
| Retrocopy | TVWTRKVGANRRALEGK*MAIDVLHPGKAAVPMAEIQEKVIQVDGTT<TDAFFVFGCRTHFGGGKRIGFG |
| Parental | MIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRG |
| .IY.SL.YAK.N...HR.A..G..EKKKTSRKQ.KE..NR.K...G | |
| Retrocopy | LIYESLNYAKTNDLEHRFATRGPCEKKKTSRKQGKEQSNRVKSITG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 228 .23 RPM |
| SRP017611_kidney | 0 .00 RPM | 255 .33 RPM |
| SRP017611_liver | 0 .04 RPM | 152 .39 RPM |
| SRP040447_lung | 0 .00 RPM | 260 .66 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 206 .26 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017818 | 17 retrocopies | |
| Cavia porcellus | ENSCPOG00000020096 | 3 retrocopies |
retro_cpor_1333 , retro_cpor_14, retro_cpor_923,
|
| Dipodomys ordii | ENSDORG00000000189 | 4 retrocopies | |
| Felis catus | ENSFCAG00000000849 | 3 retrocopies | |
| Gadus morhua | ENSGMOG00000012595 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000027878 | 10 retrocopies | |
| Myotis lucifugus | ENSMLUG00000024102 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000003778 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000025290 | 13 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000012472 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000010189 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000006715 | 1 retrocopy |