RetrogeneDB ID: | retro_mmus_2579 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 5:75108634..75108888(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ndufa2 | ||
| Ensembl ID: | ENSMUSG00000014294 | ||
| Aliases: | Ndufa2, AV000592, B8, C1-B8, CI-B8 | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 [Source:MGI Symbol;Acc:MGI:1343103] |
| Percent Identity: | 61.63 % |
| Parental protein coverage: | 83.84 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MAAAAASRAVGAKLGLREIRVHLCQRSPGSQG--VRDFIVQRYVE-LKKAHPNLPILIRECSEVQPKLWA |
| MA..A.SR.VGAKLGL.E.R.HLCQRS...QG..VR.F..Q..VE..K..H..LPILIR.CSEVQPKLWA | |
| Retrocopy | MAVTAVSRVVGAKLGLCETRIHLCQRSSPRQGKDVRNFMLQWRVE<VKDEHSDLPILIR*CSEVQPKLWA |
| Parental | RYAFGQEKTVSLNNLS |
| .YAFGQE...S..... | |
| Retrocopy | GYAFGQENNLSADEVT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 46 .28 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 40 .90 RPM |
| SRP007412_heart | 0 .00 RPM | 156 .21 RPM |
| SRP007412_kidney | 0 .00 RPM | 95 .63 RPM |
| SRP007412_liver | 0 .00 RPM | 62 .29 RPM |
| SRP007412_testis | 0 .05 RPM | 52 .10 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000015041 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000005861 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016525 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000009178 | 2 retrocopies | |
| Latimeria chalumnae | ENSLACG00000005796 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000014294 | 1 retrocopy |
retro_mmus_2579 ,
|
| Nomascus leucogenys | ENSNLEG00000009325 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000027727 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015860 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017571 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000014371 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005978 | 1 retrocopy |