RetrogeneDB ID: | retro_mmus_1676 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 17:91782000..91782441(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | 2700062C07Rik | ||
| Ensembl ID: | ENSMUSG00000024273 | ||
| Aliases: | 2700062C07Rik, AI195775, C87515 | ||
| Description: | RIKEN cDNA 2700062C07 gene [Source:MGI Symbol;Acc:MGI:1915296] |
| Percent Identity: | 62.42 % |
| Parental protein coverage: | 67.74 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 2 |
| Parental | KYYIEAAARGLVGSCPGQARYLLWAYSSTHEDNSTFQETCPHCFQLLVLDNSRVRLKPKA-KLTPKIQKL |
| .YY......GLV.SCP.QA..LL.A.SST..DNSTFQ.TC.HCFQLL.LDNSRV.L.PK...L..KIQKL | |
| Retrocopy | EYYLTSGPSGLVESCPSQAV*LL*AFSSTDKDNSTFQDTCLHCFQLLPLDNSRVNLIPKI<LLMSKIQKL |
| Parental | LNREARNDTLSF-KEAKLLRKYKDSTSVLLITCRTCNRTVRHHGKSRSFLWALKSNAATAANKASPKTPK |
| LN.EA.N.TL.F.....L..KYK.STSV.LIT.RTC.RTV...G.SRSFL.ALKSN.AT..NKA.PK..K | |
| Retrocopy | LN*EAKNPTLTF>QKGQLFKKYKASTSVYLITSRTCKRTVGSSGESRSFL*ALKSNTATGVNKATPKSKK |
| Parental | RTAPGSANL |
| R..P.S..L | |
| Retrocopy | RKDPDSSSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 7 .78 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 8 .77 RPM |
| SRP007412_heart | 0 .00 RPM | 2 .15 RPM |
| SRP007412_kidney | 0 .00 RPM | 4 .64 RPM |
| SRP007412_liver | 0 .00 RPM | 3 .80 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .96 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000029548 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000021041 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000025449 | 1 retrocopy | |
| Felis catus | ENSFCAG00000000626 | 1 retrocopy | |
| Homo sapiens | ENSG00000141428 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000026334 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000018782 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000025605 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024273 | 2 retrocopies |
retro_mmus_1676 , retro_mmus_610,
|
| Nomascus leucogenys | ENSNLEG00000006237 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000028046 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000011163 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000009110 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000009973 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000009174 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000016670 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000010817 | 2 retrocopies |