RetrogeneDB ID: | retro_mmul_2018 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 6:74446273..74446524(+) | ||
| Located in intron of: | ENSMMUG00000001360 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.9909 | ||
| Ensembl ID: | ENSMMUG00000004899 | ||
| Aliases: | None | ||
| Description: | V-type proton ATPase subunit G 1 [Source:RefSeq peptide;Acc:NP_001180531] |
| Percent Identity: | 62.64 % |
| Parental protein coverage: | 76.27 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | RAAEKVSEARKRKN-RRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSHGSCSTEVEKETQEKMTILQ |
| R....VSE.....N.RR.KQ.K..AQ.EIE.Y.LQR.KEFKAKEAAALGS.GSCST.VE.ETQ.K.TI.. | |
| Retrocopy | RLLKRVSETCSERN<RRQKQTKAAAQGEIE*YCLQRQKEFKAKEAAALGSQGSCSTKVE-ETQ*KRTI-R |
| Parental | TYFRQNRDEVLDNLLAFVCDI |
| ..FRQ.R.EVL....AF.CDI | |
| Retrocopy | K*FRQKRGEVL----AFFCDI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 23 .98 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 25 .86 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 23 .89 RPM |
| SRP007412_heart | 0 .00 RPM | 22 .73 RPM |
| SRP007412_kidney | 0 .00 RPM | 36 .50 RPM |
| SRP007412_liver | 0 .00 RPM | 10 .37 RPM |
| SRP007412_testis | 0 .08 RPM | 44 .70 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3198 |
| Pan troglodytes | retro_ptro_2248 |
| Gorilla gorilla | retro_ggor_1331 |