RetrogeneDB ID: | retro_fcat_1614 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | D4:25001573..25001783(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP6V1G1 | ||
| Ensembl ID: | ENSFCAG00000000160 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 [Source:HGNC Symbol;Acc:864] |
| Percent Identity: | 60.27 % |
| Parental protein coverage: | 60.17 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | MASQSQGIQQLLQAEKRA-AEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEF-KAKEAAALGSHGS |
| M..QSQG.QQLL.AEK...A.KVS.....K...LKQAK...QAE.EQY.LQREK...KA....ALGSHGS | |
| Retrocopy | MTCQSQGLQQLL*AEKWV<AQKVSKVHMQKK*KLKQAKP-TQAETEQYSLQREKSV>KAEDTVALGSHGS |
| Parental | CST |
| CS. | |
| Retrocopy | CSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 25 .71 RPM |
| SRP017611_kidney | 0 .10 RPM | 44 .31 RPM |
| SRP017611_liver | 0 .00 RPM | 13 .14 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012509 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020461 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008083 | 15 retrocopies | |
| Dipodomys ordii | ENSDORG00000014850 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000008080 | 3 retrocopies | |
| Felis catus | ENSFCAG00000000160 | 2 retrocopies |
retro_fcat_1614 , retro_fcat_402,
|
| Loxodonta africana | ENSLAFG00000013437 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000008657 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000004899 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000019574 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000001653 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000039105 | 5 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000026252 | 3 retrocopies |