RetrogeneDB ID: | retro_mmul_1937 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 5:27520709..27520994(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBE2D4 | ||
| Ensembl ID: | ENSMMUG00000002410 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2D 4 (putative) [Source:HGNC Symbol;Acc:21647] |
| Percent Identity: | 88.54 % |
| Parental protein coverage: | 65.31 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT |
| MALKRI.KEL.DL..D.PAQCSAG.VG.D.FHWQ.TIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT | |
| Retrocopy | MALKRIHKELNDLAWDLPAQCSAGLVGEDMFHWQVTIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT |
| Parental | TKIYHPNINSNGSICLDILRSQWSPA |
| ..IYHPNINSNGSICLDILRSQWSPA | |
| Retrocopy | -RIYHPNINSNGSICLDILRSQWSPA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .11 RPM | 27 .45 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 35 .14 RPM |
| SRP007412_cerebellum | 0 .13 RPM | 21 .25 RPM |
| SRP007412_heart | 0 .29 RPM | 24 .91 RPM |
| SRP007412_kidney | 0 .00 RPM | 28 .05 RPM |
| SRP007412_liver | 0 .12 RPM | 27 .35 RPM |
| SRP007412_testis | 2 .00 RPM | 68 .79 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003997 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007875 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000006888 | 5 retrocopies | |
| Homo sapiens | ENSG00000078967 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000003378 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011919 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000002410 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000008069 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000020666 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003364 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000008900 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000029727 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000016722 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000003691 | 9 retrocopies | |
| Tarsius syrichta | ENSTSYG00000000595 | 14 retrocopies |