RetrogeneDB ID: | retro_sscr_671 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 2:63747551..63747938(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSSSCG00000028356 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBE2D4 | ||
| Ensembl ID: | ENSSSCG00000016722 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2D 4 (putative) [Source:HGNC Symbol;Acc:21647] |
| Percent Identity: | 69.92 % |
| Parental protein coverage: | 87.07 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 4 |
| Parental | MALKRIQ-KELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVF-FLTIHFPTDYPFKPPKVA |
| MALK.IQ.K.L.DLQ.DPP..CS.G.VGDDLF..Q.TIM.P.DS.YQG.V..FLT.H.PTDY.FK..K.. | |
| Retrocopy | MALKWIQ>K*LSDLQSDPPIHCSTGLVGDDLFYRQETIMAPPDSTYQGRVL<FLTVHPPTDYSFKASKIS |
| Parental | FTTKIYHPNINSNGSICL-DILRSQWSPA-LTVSKVLLSICSLLCDPNP-DDPLVPEIAHTYK |
| FTTK.YHPN..SNGSICL..ILRSQ.SPA.L.VSKV.LS.CSLLCDP.P.DDPLVP.IA..YK | |
| Retrocopy | FTTKVYHPNSKSNGSICL<NILRSQRSPA>LAVSKVSLSVCSLLCDPSPDDDPLVPDIAQIYK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 9 .29 RPM |
| SRP014902_testis | 0 .00 RPM | 15 .98 RPM |
| SRP018288_heart | 0 .00 RPM | 32 .77 RPM |
| SRP018288_kidney | 0 .00 RPM | 18 .81 RPM |
| SRP018288_liver | 0 .00 RPM | 5 .92 RPM |
| SRP018288_lung | 0 .00 RPM | 25 .05 RPM |
| SRP018856_adipose | 0 .03 RPM | 29 .85 RPM |
| SRP035408_brain | 0 .00 RPM | 31 .25 RPM |
| SRP035408_liver | 0 .00 RPM | 7 .52 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003997 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007875 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000006888 | 5 retrocopies | |
| Homo sapiens | ENSG00000078967 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000003378 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011919 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000002410 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003364 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000008900 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000029727 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011209 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000016722 | 2 retrocopies |
retro_sscr_671 , retro_sscr_79,
|
| Sus scrofa | ENSSSCG00000024306 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000029822 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000003691 | 9 retrocopies | |
| Tarsius syrichta | ENSTSYG00000000595 | 14 retrocopies |