RetrogeneDB ID: | retro_mmul_1244 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 16:1401042..1401254(-) | ||
| Located in intron of: | ENSMMUG00000017561 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.3940 | ||
| Ensembl ID: | ENSMMUG00000018788 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 57.33 % |
| Parental protein coverage: | 71.15 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | ALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQVSGSKERLGFPSYIWYLGWH-YGNEILQLWKIHA |
| A.V.SGG..G.VK.....S...G.LF.S...L.A..VSGS...LGF.SY.W.LG.H.YGNEIL.LWK.HA | |
| Retrocopy | APVVSGGVVGCVKQAMCVS-GCGALFSSPECLLA--VSGSRKHLGFHSYSWSLGGH<YGNEILPLWKMHA |
| Parental | CRFNC |
| .RFNC | |
| Retrocopy | HRFNC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 16 .81 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 18 .17 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 20 .92 RPM |
| SRP007412_heart | 0 .00 RPM | 28 .27 RPM |
| SRP007412_kidney | 0 .23 RPM | 33 .92 RPM |
| SRP007412_liver | 0 .04 RPM | 43 .82 RPM |
| SRP007412_testis | 0 .00 RPM | 5 .16 RPM |