RetrogeneDB ID: | retro_mdom_467 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:713326612..713327004(+) | ||
| Located in intron of: | ENSMODG00000023058 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMODG00000021273 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 81.82 % |
| Parental protein coverage: | 68.59 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | SQRYPDIRIEGENYLPQPIYRHIASFLSVFKLV-LIGLIIVGKDPFAFFGMQAPSIWQWGQENKIYACMM |
| SQR.PDI.I.GENYLPQ.IYR.I.SFLSVFKL...IGLIIVGKDPFAFFGMQ.PS.WQWGQENKI.ACMM | |
| Retrocopy | SQRHPDIHIQGENYLPQKIYRYIPSFLSVFKLI<IIGLIIVGKDPFAFFGMQVPSFWQWGQENKISACMM |
| Parental | VFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHH |
| VFFL.NMIENQCMSTG.FEITLND.P.W.KLE.GHLPSM..L.QILDN.MKLNVH..SIPHH | |
| Retrocopy | VFFLRNMIENQCMSTGTFEITLNDAPLWTKLEFGHLPSM*HLIQILDNKMKLNVHIHSIPHH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000001394 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000002576 | 1 retrocopy | |
| Equus caballus | ENSECAG00000025123 | 2 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000013363 | 2 retrocopies | |
| Homo sapiens | ENSG00000198843 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000028291 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014738 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000021273 | 1 retrocopy |
retro_mdom_467 ,
|
| Mus musculus | ENSMUSG00000075700 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000003284 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000013866 | 9 retrocopies | |
| Ochotona princeps | ENSOPRG00000014425 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000029483 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000039581 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000013507 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000018506 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000007410 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007522 | 2 retrocopies |