RetrogeneDB ID: | retro_meug_2036 | ||
Retrocopy location | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold81980:3830..4052(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMEUG00000014738 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.33 % |
| Parental protein coverage: | 67.57 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | PFAFFGMPAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQ |
| P..F.GM.A.S..QWG.ENKVY.C..VF......E..C....A.EITL.D.P.WSK.E..HL.SMQ..V. | |
| Retrocopy | PGLFSGMQALSNQQWG*ENKVYVCVVVFSK*HDPEPVCVNS-ASEITLSDAPEWSKQEPDHLSSMQKIV* |
| Parental | ILDNE |
| .LDNE | |
| Retrocopy | VLDNE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000001394 | 2 retrocopies | |
| Equus caballus | ENSECAG00000025123 | 2 retrocopies | |
| Homo sapiens | ENSG00000198843 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000028291 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014738 | 3 retrocopies |
retro_meug_1766, retro_meug_1786, retro_meug_2036 ,
|
| Monodelphis domestica | ENSMODG00000021273 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000075700 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000003284 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000014425 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000039581 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000013507 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000018506 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000007410 | 3 retrocopies |