RetrogeneDB ID: | retro_mdom_342 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:228400061..228400301(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMODG00000002011 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 65.0 % |
| Parental protein coverage: | 57.14 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | HLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVG |
| HLMK.I...PV...S.K.Q.EERER..NYVP.VSALD.EIIEVDPDTK.MLKLLDF..LSNLQ.....V. | |
| Retrocopy | HLMKCI*GDPVTDLSSKMQKEERERLYNYVPHVSALDEEIIEVDPDTKRMLKLLDFSNLSNLQLILLAVR |
| Parental | MNFKTPRGAV |
| .NF.TP..A. | |
| Retrocopy | INF*TPKVAI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 276 .42 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 207 .30 RPM |
| SRP007412_heart | 0 .00 RPM | 660 .65 RPM |
| SRP007412_kidney | 0 .00 RPM | 655 .78 RPM |
| SRP007412_liver | 0 .00 RPM | 868 .52 RPM |
| SRP007412_testis | 0 .00 RPM | 521 .33 RPM |