RetrogeneDB ID: | retro_dnov_673 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_751:67246..67492(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSDNOG00000016087 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000012633 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 100.0 % |
| Parental protein coverage: | 60.74 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | VTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPT |
| VTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPT | |
| Retrocopy | VTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPT |
| Parental | VGMNFKTPRGAV |
| VGMNFKTPRGAV | |
| Retrocopy | VGMNFKTPRGAV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .39 RPM | 304 .15 RPM |
| SRP012922_cerebellum | 0 .27 RPM | 94 .03 RPM |
| SRP012922_heart | 0 .23 RPM | 193 .51 RPM |
| SRP012922_kidney | 0 .82 RPM | 302 .00 RPM |
| SRP012922_liver | 0 .62 RPM | 162 .86 RPM |
| SRP012922_lung | 0 .15 RPM | 321 .48 RPM |
| SRP012922_quadricep_muscle | 0 .35 RPM | 272 .26 RPM |
| SRP012922_spleen | 0 .34 RPM | 467 .23 RPM |