RetrogeneDB ID: | retro_dnov_1296 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_177353:164..394(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSDNOG00000012179 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000012633 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 78.21 % |
| Parental protein coverage: | 57.04 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGM-N |
| K.IQRGP.R.ISIKLQEEE.ERR.NYVP.VS.LDQEI.E..PDTKEMLKLLDF.SLS.LQVTQPTVGM.. | |
| Retrocopy | KWIQRGPMRDISIKLQEEEKERRENYVPVVSTLDQEITEIGPDTKEMLKLLDFSSLSTLQVTQPTVGM<D |
| Parental | FKTPRGAV |
| FKTP.G.. | |
| Retrocopy | FKTPCGTI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 304 .15 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 94 .03 RPM |
| SRP012922_heart | 0 .00 RPM | 193 .51 RPM |
| SRP012922_kidney | 0 .00 RPM | 302 .00 RPM |
| SRP012922_liver | 0 .00 RPM | 162 .86 RPM |
| SRP012922_lung | 0 .00 RPM | 321 .48 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 272 .26 RPM |
| SRP012922_spleen | 0 .00 RPM | 467 .23 RPM |