RetrogeneDB ID: | retro_mdom_331 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:164789539..164789962(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMODG00000001899 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 78.72 % |
| Parental protein coverage: | 64.68 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | ILRYIARQYNLCGETEEERIRVDMLENHVMDIRMQLARVCYNPNFEVMKIEYLQQLPGQLKLFSLFLGKC |
| IL.YIA..YNLC.E.EEE.I.VD.LENH.MDI.MQL..VCYNPNFE..KIE.L.QLPGQLKLFSLFLGKC | |
| Retrocopy | ILHYIAQKYNLCSEMEEEHIQVDVLENHIMDIQMQLVHVCYNPNFEIIKIECLHQLPGQLKLFSLFLGKC |
| Parental | SWFAGNKITFVDFLVYDVLDQNRKFEPSCLEKFSNLKEFLHRFESLSSIATYLASERCQPYPIFAKMACW |
| .WFAGNKIT.VDFLV.DVLDQN.KFEP.CL.KF..LKEFLH.FESLSSI.TYLA.E.CQ.YPIF.KMACW | |
| Retrocopy | TWFAGNKITYVDFLV*DVLDQN*KFEPTCL*KFLKLKEFLHWFESLSSISTYLAFEHCQLYPIFTKMACW |
| Parental | G |
| G | |
| Retrocopy | G |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .33 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000005380 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000003168 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000014211 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000005817 | 2 retrocopies | |
| Homo sapiens | ENSG00000134202 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000005185 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000008029 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000001899 | 1 retrocopy |
retro_mdom_331 ,
|
| Mus musculus | ENSMUSG00000004032 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003302 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000001063 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000047034 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000006821 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006736 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009682 | 1 retrocopy |