RetrogeneDB ID: | retro_mdom_1888 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 8:244221953..244222196(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS19 | ||
| Ensembl ID: | ENSMODG00000010067 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S19 [Source:HGNC Symbol;Acc:10402] |
| Percent Identity: | 65.06 % |
| Parental protein coverage: | 52.87 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | VTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAASTARHLYLRGGAGVG |
| VT.KD..QQE.VRALAA.LKKSGK.K.PE.VD..KLAKH..L..YDE.W.Y..A.STA.HL.L.G.AGV. | |
| Retrocopy | VTGKDIKQQESVRALAAVLKKSGKQKIPEGVDMIKLAKHEALPFYDEDWLYIQASSTACHLSLPGDAGVE |
| Parental | SMTKIYGGRQRNG |
| S..KIY.GRQ..G | |
| Retrocopy | S--KIYDGRQKMG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000011963 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000028485 | 10 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020243 | 5 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000002376 | 4 retrocopies | |
| Equus caballus | ENSECAG00000009738 | 2 retrocopies | |
| Homo sapiens | ENSG00000105372 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000004554 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013429 | 8 retrocopies | |
| Monodelphis domestica | ENSMODG00000010067 | 3 retrocopies |
retro_mdom_1531, retro_mdom_1888 , retro_mdom_883,
|
| Mustela putorius furo | ENSMPUG00000007164 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000040952 | 15 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026255 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000048199 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000003042 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000003502 | 3 retrocopies |