RetrogeneDB ID: | retro_ggor_255 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 1:80378351..80378711(+) | ||
| Located in intron of: | ENSGGOG00000004987 | ||
Retrocopy information | Ensembl ID: | ENSGGOG00000027765 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SSR3 | ||
| Ensembl ID: | ENSGGOG00000024038 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 91.67 % |
| Parental protein coverage: | 60.61 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAPKGSSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVST |
| MAPKGSSKQ.SEEDLLLQDFS.NLSAKS.A.FF.NAF.VSAIPIWLYWRIWHMDLIQSAV.YSVMTL.ST | |
| Retrocopy | MAPKGSSKQPSEEDLLLQDFSGNLSAKSFAIFFRNAFVVSAIPIWLYWRIWHMDLIQSAVFYSVMTLEST |
| Parental | YLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDER |
| YLVAFAYKNVKFVLKHKVAQKRED.VSKEVTRKLSEADNRKMSRKEKD.R | |
| Retrocopy | YLVAFAYKNVKFVLKHKVAQKREDTVSKEVTRKLSEADNRKMSRKEKDVR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 29 .40 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 27 .15 RPM |
| SRP007412_heart | 0 .09 RPM | 20 .04 RPM |
| SRP007412_kidney | 0 .12 RPM | 80 .43 RPM |
| SRP007412_liver | 0 .03 RPM | 74 .89 RPM |
| SRP007412_testis | 0 .00 RPM | 140 .79 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_173 |
| Pan troglodytes | retro_ptro_163 |
| Pongo abelii | retro_pabe_456 |
| Macaca mulatta | retro_mmul_383 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003125 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000008870 | 5 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000001517 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004643 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000005898 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000000752 | 2 retrocopies | |
| Homo sapiens | ENSG00000114850 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000024038 | 1 retrocopy |
retro_ggor_255 ,
|
| Myotis lucifugus | ENSMLUG00000015478 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000016970 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000010589 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000014233 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015560 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000010578 | 1 retrocopy |