RetrogeneDB ID: | retro_ggor_1406 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 18:29289448..29289664(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSGGOG00000022720 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS15A | ||
| Ensembl ID: | ENSGGOG00000026299 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 95.89 % |
| Parental protein coverage: | 56.15 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | RAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHTGGKIL |
| R.GKI.VNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPS.QFGFIVLTTSAGIMDHEEARRKHTGGKIL | |
| Retrocopy | RGGKI-VNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSCQFGFIVLTTSAGIMDHEEARRKHTGGKIL |
| Parental | GFF |
| GFF | |
| Retrocopy | GFF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 45 .56 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 56 .77 RPM |
| SRP007412_heart | 0 .00 RPM | 48 .53 RPM |
| SRP007412_kidney | 0 .00 RPM | 183 .39 RPM |
| SRP007412_liver | 0 .00 RPM | 220 .31 RPM |
| SRP007412_testis | 0 .00 RPM | 121 .21 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1932 |