RetrogeneDB ID: | retro_fcat_1728 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | E3:21615792..21616008(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS26 | ||
| Ensembl ID: | ENSFCAG00000013977 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S26 [Source:HGNC Symbol;Acc:10414] |
| Percent Identity: | 63.89 % |
| Parental protein coverage: | 62.61 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | NIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAPRPPP |
| N..EA..VRDIS..SV..A.VLP.L.VK.H.C.SCA...K.VRNRS..A..DRTPPP..RPAGAAP.P.P | |
| Retrocopy | NMAEATLVRDISKVSVLGACVLPRLHVKPHSCLSCAVSGKTVRNRSGTAQEDRTPPPQLRPAGAAP*PSP |
| Parental | KP |
| KP | |
| Retrocopy | KP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 39 .94 RPM |
| SRP017611_kidney | 0 .00 RPM | 119 .55 RPM |
| SRP017611_liver | 0 .00 RPM | 78 .95 RPM |