RetrogeneDB ID: | retro_etel_269 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | GeneScaffold_4536:22788..23022(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSETEG00000004510 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 74.36 % |
| Parental protein coverage: | 66.67 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | VIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPP--PRFRPAGAA |
| .IRN..E.AAVRDISE.SV.DA.VLPKL.VKL.YC.SCAIHSKV.RNRSREARK..TPP..P.FR.AGAA | |
| Retrocopy | IIRNTMETAAVRDISETSVSDACVLPKLDVKLYYCMSCAIHSKVARNRSREARKY*TPPPLPQFRSAGAA |
| Parental | PRPPPKPM |
| P..PPKP. | |
| Retrocopy | PQLPPKPI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |