RetrogeneDB ID: | retro_ecab_754 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 30:29768984..29769215(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSECAG00000016621 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 55.0 % |
| Parental protein coverage: | 52.98 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | RIPGFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSS |
| R.P.FN...............AGDI.D.LL...DFL.FK.MFLDYRAEK.G..L.LSSGLV.TSLCKSSS | |
| Retrocopy | RLPEFNVVV---SKHYSSQKMAGDILDRLLPCMDFLSFKDMFLDYRAEKGGLALGLSSGLVATSLCKSSS |
| Parental | VPASQNSLRP |
| ....Q..L.P | |
| Retrocopy | QDTLQH*LSP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 47 .87 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 109 .53 RPM |
| SRP021940_embryo | 0 .08 RPM | 61 .40 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 32 .91 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 48 .32 RPM |
| SRP021940_testis | 0 .13 RPM | 174 .12 RPM |