RetrogeneDB ID: | retro_ecab_174 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 1:78145488..78145991(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C9orf78 | ||
| Ensembl ID: | ENSECAG00000018958 | ||
| Aliases: | None | ||
| Description: | chromosome 9 open reading frame 78 [Source:HGNC Symbol;Acc:24932] |
| Percent Identity: | 58.66 % |
| Parental protein coverage: | 59.52 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 7 |
| Parental | QMKTGGMVDMKKLKERGKDKISEEED-LHLGTSFSAETNRRDEDADMMKYIETELKKRKGIVEH-EEQKV |
| QMKTGGM.DM..LK.RG..KIS.EED..HL.TSF.AETN.R...A.MMK.......KRKGI.EH..EQK. | |
| Retrocopy | QMKTGGMDDMRRLKDRGTEKISREED<PHLRTSFCAETN*RHKAAHMMKSVKMKV-KRKGIIEH<QEQKI |
| Parental | KPKNAE-DCLYELPENIRVSSAKKTEEML-SNQMLSGIPEVDLGI-DAKIKNIISTEDAKARLLAEQQNK |
| ..KNA.....YEL.EN...SSAKKT.E.L.S..MLS.IP.V.L...DAKI.NI...EDAKA.LLAEQQN. | |
| Retrocopy | NSKNAD<SYAYELVENLHASSAKKTVEYL<SKWMLSSIPIVGLHM<DAKIRNIF-MEDAKAQLLAEQQNR |
| Parental | -KKDSETSFVPTNMAVNYVQH-NRFYHEELNAPIRRNKE |
| .KKDSET....T..AV.Y.Q..N..YH...NAP.RR.K. | |
| Retrocopy | <KKDSETFCGSTIVAVSYGQQ<NQSYHQVFNAPRRRTKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 22 .14 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 34 .79 RPM |
| SRP021940_embryo | 0 .00 RPM | 38 .36 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 27 .38 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 26 .88 RPM |
| SRP021940_testis | 0 .00 RPM | 51 .03 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_320 |
| Pan troglodytes | retro_ptro_258 |
| Callithrix jacchus | retro_cjac_1757 |
| Bos taurus | retro_btau_1138 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000020307 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000019979 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013895 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000009285 | 1 retrocopy | |
| Equus caballus | ENSECAG00000018958 | 1 retrocopy |
retro_ecab_174 ,
|
| Gorilla gorilla | ENSGGOG00000013358 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000010524 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000009596 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000006832 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000026851 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000009770 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000019685 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000012313 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000020630 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013115 | 1 retrocopy |