RetrogeneDB ID: | retro_ecab_1084 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | X:79834898..79835268(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP1B3 | ||
| Ensembl ID: | ENSECAG00000019885 | ||
| Aliases: | None | ||
| Description: | ATPase, Na+/K+ transporting, beta 3 polypeptide [Source:HGNC Symbol;Acc:806] |
| Percent Identity: | 76.98 % |
| Parental protein coverage: | 51.03 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | CSGVEDPEFGYSTGNPCILVKMNRIIGLKPQGKPRINCISK-GEKTATLSTYPSNGTIDLKYFPYYGKKL |
| CSGV.DPEFGYS.G..CILVKM.RIIGLK.QG.P.I.CISK.G.K..TLSTYP.NG.IDLKYFPYYGKKL | |
| Retrocopy | CSGVDDPEFGYSRGKSCILVKMSRIIGLKTQGEPMIQCISK<GWKHTTLSTYPPNGIIDLKYFPYYGKKL |
| Parental | HVRYLQPLVAVQVAFNTTSTGKEVTVECKIDGSPNL-RNQDDRDKFLGRVVFKITM |
| HV.Y.QPLVAVQV...T.ST..EV.VECKIDG.PNL..NQDDRDK.LGRVVFKIT. | |
| Retrocopy | HVKYPQPLVAVQVTCDTSSTI*EVRVECKIDGLPNL<KNQDDRDKLLGRVVFKITV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 30 .58 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 59 .98 RPM |
| SRP021940_embryo | 0 .00 RPM | 41 .27 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 54 .13 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 54 .05 RPM |
| SRP021940_testis | 0 .00 RPM | 58 .89 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Bos taurus | retro_btau_1743 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000014140 | 5 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000007515 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001981 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000003739 | 4 retrocopies | |
| Equus caballus | ENSECAG00000019885 | 2 retrocopies |
retro_ecab_1084 , retro_ecab_468,
|
| Homo sapiens | ENSG00000069849 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000010553 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032412 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004663 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008662 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000013927 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014169 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015476 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000011501 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000011676 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000013235 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001004 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000000222 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000012038 | 1 retrocopy |