RetrogeneDB ID: | retro_dnov_913 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_12087:83281..83486(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000010228 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.22 % |
| Parental protein coverage: | 63.06 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | QRVEDVRLIREQHPTKIPVIIERY-KGEKQLPVLDKTKFLV-PDHVNMSELIKIIRRRLQLNANQAFFLL |
| Q.VEDV.LI.EQHP.K..V.IER..KGEK.LPVLDK.K.LV...HVNMSELIKIIRR..QLNA...FFLL | |
| Retrocopy | Q*VEDVHLIGEQHPVKVSVTIERT<KGEKHLPVLDKSKSLV<MVHVNMSELIKIIRRYFQLNA-MNFFLL |
| Parental | VN |
| VN | |
| Retrocopy | VN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 21 .00 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 28 .32 RPM |
| SRP012922_heart | 0 .00 RPM | 24 .60 RPM |
| SRP012922_kidney | 0 .00 RPM | 49 .01 RPM |
| SRP012922_liver | 0 .00 RPM | 43 .50 RPM |
| SRP012922_lung | 0 .00 RPM | 39 .10 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 45 .00 RPM |
| SRP012922_spleen | 0 .00 RPM | 32 .96 RPM |