RetrogeneDB ID: | retro_cpor_950 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_36:19146984..19147326(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RBM3 | ||
| Ensembl ID: | ENSCPOG00000003553 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 55.93 % |
| Parental protein coverage: | 76.67 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | MSSEEGKLFVGGLNFSTDEQALE-DHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMRAMNG |
| MSS.....F...L.F...E..LE.D...SFG....VVVVKD.ETQR...FGFI.FTN.E..SDA.R.MNG | |
| Retrocopy | MSSKRRLFFLTELKFNANEHTLE<DYIISFGLVTVVVVVKDQETQRCQSFGFIAFTNSEYTSDAIRVMNG |
| Parental | ESLDGRQIRVD-HAGKSARGTR-GGGAFGAHGRGRSYSRGGGDQGYGS |
| ESLDG.QIR.D.H.G.S..GTR..G.A...H.R..SYSR..GDQ..GS | |
| Retrocopy | ESLDGHQIRAD<HVG*SSQGTR<RGSACETHERL*SYSRDDGDQSCGS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .06 RPM | 28 .87 RPM |
| SRP017611_kidney | 0 .00 RPM | 37 .58 RPM |
| SRP017611_liver | 0 .00 RPM | 14 .84 RPM |
| SRP040447_lung | 0 .00 RPM | 51 .07 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 19 .60 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000013718 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000025848 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000015485 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000003553 | 1 retrocopy |
retro_cpor_950 ,
|
| Cavia porcellus | ENSCPOG00000006313 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012164 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010420 | 16 retrocopies | |
| Gadus morhua | ENSGMOG00000012137 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000007003 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020314 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000021591 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000027493 | 1 retrocopy |