RetrogeneDB ID: | retro_cpor_732 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_25:13500929..13501167(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL34 | ||
| Ensembl ID: | ENSCPOG00000000802 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 54.88 % |
| Parental protein coverage: | 68.38 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | RLSYNTASNKTRLSR-TPGNRIVYLYTKKVGKAPKSACGVC-PGRLRGVRAVRPKVLMRLSKTKKHVSRA |
| RL....A..KTRL...T.GNR.V.L.....G..PKS....C.PG...GVRAVRPK.L.RLSKT.K....A | |
| Retrocopy | RLFSSAALDKTRLCE<THGNRNVGLS*QENGEVPKSVHAAC<PGPP*GVRAVRPKDLRRLSKTRKGAGEA |
| Parental | YGGSMCAKCVRD |
| .GGSMCA.CV.D | |
| Retrocopy | EGGSMCATCVHD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 90 .42 RPM |
| SRP017611_kidney | 0 .00 RPM | 142 .90 RPM |
| SRP017611_liver | 0 .00 RPM | 86 .97 RPM |
| SRP040447_lung | 0 .00 RPM | 189 .84 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 148 .17 RPM |