RetrogeneDB ID: | retro_btau_1303 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 3:107534752..107534998(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BT.49114 | ||
| Ensembl ID: | ENSBTAG00000014226 | ||
| Aliases: | None | ||
| Description: | 60S ribosomal protein L34 [Source:RefSeq peptide;Acc:NP_001193150] |
| Percent Identity: | 60.24 % |
| Parental protein coverage: | 64.84 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | RLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTKKHVSRAYG |
| RL...TAS.KTRLS..P.NR..YLYT...GKAP.S..GVCPG.L.GVR.VR.KVLMR.S...KH.SR... | |
| Retrocopy | RLCSSTASTKTRLS*IPDNRVIYLYTEDAGKAPTSTRGVCPGGL*GVRTVRHKVLMRFSE-RKHISRPVV |
| Parental | GSMCAKCVRDRIK |
| ...CAKCV.D.I. | |
| Retrocopy | VTVCAKCVYDKIR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 105 .91 RPM |
| ERP005899_muscle | 0 .00 RPM | 575 .82 RPM |
| SRP017611_brain | 0 .00 RPM | 50 .80 RPM |
| SRP017611_kidney | 0 .00 RPM | 134 .37 RPM |
| SRP017611_liver | 0 .00 RPM | 76 .57 RPM |
| SRP030211_testis | 0 .00 RPM | 71 .69 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Sus scrofa | retro_sscr_845 |