RetrogeneDB ID: | retro_cpor_327 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_127:2162170..2162405(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DNAJC15 | ||
| Ensembl ID: | ENSCPOG00000003485 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.16 % |
| Parental protein coverage: | 52.35 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | LEQIITETARKISSPNLSSYYKG-GFEQKMSRREASLILGVSPSAGKAKIRTAHKKIMILNHPDKGGSPY |
| .E.......RK..S.N..S.YK..G..Q..SRREASLILGVSPSAG.A.IRT.H.KIMILN..D...... | |
| Retrocopy | IENVYSKNHRKCESFNP*SSYKK>GLKQTTSRREASLILGVSPSAGEAEIRTVHRKIMILN*AD*Q*LAC |
| Parental | LAAKINEAK |
| LA..I..A. | |
| Retrocopy | LATQIYKAE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 8 .22 RPM |
| SRP017611_kidney | 0 .00 RPM | 7 .12 RPM |
| SRP017611_liver | 0 .00 RPM | 10 .23 RPM |
| SRP040447_lung | 0 .00 RPM | 5 .40 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 4 .31 RPM |