RetrogeneDB ID: | retro_cfam_647 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 15:6422214..6422447(+) | ||
| Located in intron of: | ENSCAFG00000003539 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP5G1 | ||
| Ensembl ID: | ENSCAFG00000016880 | ||
| Aliases: | None | ||
| Description: | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9) [Source:HGNC Symbol;Acc:841] |
| Percent Identity: | 62.5 % |
| Parental protein coverage: | 58.09 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MQTTG-ALLIPPALIRCCTRDLIRPLSASFLSRPEIPSKQPSYSSSPLQVARREFQTSVVSRDIDTAAKF |
| .Q.TG.ALLIP.ALI..CTR..IRP.SAS.LSRP.IPS.QPS.SSSP......EFQTSVVS.DI..AA.F | |
| Retrocopy | VQPTG<ALLIPLALISGCTRGPIRPVSAS-LSRPVIPSTQPS*SSSPTPGSPMEFQTSVVSWDIAIAAPF |
| Parental | IGAGAATVGV |
| IG......G. | |
| Retrocopy | IGVAGSGAGI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 65 .69 RPM |
| SRP017611_brain | 0 .00 RPM | 60 .42 RPM |
| SRP017611_kidney | 0 .00 RPM | 738 .56 RPM |
| SRP017611_liver | 0 .00 RPM | 116 .89 RPM |