RetrogeneDB ID: | retro_sscr_897 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 7:22043437..22043812(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | AKIRIN2 | ||
| Ensembl ID: | ENSSSCG00000004307 | ||
| Aliases: | None | ||
| Description: | akirin 2 [Source:HGNC Symbol;Acc:21407] |
| Percent Identity: | 85.6 % |
| Parental protein coverage: | 61.58 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | EQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTPSATSSPLKKEQPLFTLRQV |
| .Q...NIKQE.K.MQK.RHLETSFQQ.DPCCTS.AQPHA.LLSGPASPG.PSATSSPLKKEQPLFTL.QV | |
| Retrocopy | KQHMHNIKQECKCMQKKRHLETSFQQSDPCCTSEAQPHAVLLSGPASPGVPSATSSPLKKEQPLFTLQQV |
| Parental | GMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS |
| GMICE.LLKEREEKVRE.YEEILNTK.AEQYDAFVKFTHDQI...YGEQPASYVS | |
| Retrocopy | GMICEHLLKEREEKVREKYEEILNTKRAEQYDAFVKFTHDQIL*CYGEQPASYVS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 73 .80 RPM |
| SRP014902_testis | 0 .14 RPM | 53 .18 RPM |
| SRP018288_heart | 0 .00 RPM | 24 .70 RPM |
| SRP018288_kidney | 0 .00 RPM | 47 .28 RPM |
| SRP018288_liver | 0 .00 RPM | 36 .62 RPM |
| SRP018288_lung | 0 .00 RPM | 70 .16 RPM |
| SRP018856_adipose | 0 .15 RPM | 42 .73 RPM |
| SRP035408_brain | 0 .00 RPM | 81 .15 RPM |
| SRP035408_liver | 0 .00 RPM | 32 .85 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000003082 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000012160 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000000769 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000000549 | 1 retrocopy | |
| Homo sapiens | ENSG00000135334 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002448 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002824 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016831 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000018409 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000008288 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000006084 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000011555 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000004307 | 1 retrocopy |
retro_sscr_897 ,
|