RetrogeneDB ID: | retro_dnov_1788 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_3038:131269..131601(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | AKIRIN2 | ||
| Ensembl ID: | ENSDNOG00000000549 | ||
| Aliases: | None | ||
| Description: | akirin 2 [Source:HGNC Symbol;Acc:21407] |
| Percent Identity: | 64.66 % |
| Parental protein coverage: | 56.65 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | SAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCASDAQPHAFLLS |
| ...A...QKYL.MEP.P.G..S..LTT.QILY.I..EYK.MQKRRHLE..FQQTDPC.AS..QPHAFLLS | |
| Retrocopy | ATTATKWQKYLQMEPLPLGYIS-HLTTGQILYSI--EYKHMQKRRHLEIRFQQTDPCHASATQPHAFLLS |
| Parental | GPAS-PGTSSATSSPLKKEQPLFTLRQVGMICERLLKEREEKVREE |
| GPAS..GTSSATSSP.........L.QVGMICE...K..EEKV.EE | |
| Retrocopy | GPAS<TGTSSATSSPXXXXKSPCLLQQVGMICE-C*KDHEEKV*EE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 18 .86 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 32 .03 RPM |
| SRP012922_heart | 0 .00 RPM | 11 .60 RPM |
| SRP012922_kidney | 0 .00 RPM | 26 .56 RPM |
| SRP012922_liver | 0 .15 RPM | 19 .66 RPM |
| SRP012922_lung | 0 .31 RPM | 22 .15 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 10 .21 RPM |
| SRP012922_spleen | 0 .00 RPM | 29 .76 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000003082 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000012160 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000000769 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000000332 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000000549 | 1 retrocopy |
retro_dnov_1788 ,
|
| Homo sapiens | ENSG00000135334 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002448 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002824 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016831 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000018409 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000008288 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000006084 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000011555 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000004307 | 1 retrocopy |