RetrogeneDB ID: | retro_cjac_2231 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 3:42919437..42919794(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | AKIRIN2 | ||
| Ensembl ID: | ENSCJAG00000000769 | ||
| Aliases: | None | ||
| Description: | akirin 2 [Source:HGNC Symbol;Acc:21407] |
| Percent Identity: | 75.63 % |
| Parental protein coverage: | 81.38 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected | 0 |
| Parental | KQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERL |
| ..E.K..QKRRHLE.SFQQTDPCCTSDAQPHAFLLSGPAS..TS.AASSPLK.E..LFTL.QV.MI.E.L | |
| Retrocopy | EKEKKKKQKRRHLEMSFQQTDPCCTSDAQPHAFLLSGPASTRTSFAASSPLK*E*SLFTLWQVEMIYECL |
| Parental | LKEREEKVREEYEEILNTKLAEQYDAFVKF-THDQIMRRYGEQPASYVS |
| LK..EEKV.EEYEEILNTKLAE.YDAFVKF..HDQ....Y.EQ.A.YVS | |
| Retrocopy | LKKCEEKV*EEYEEILNTKLAEHYDAFVKFIKHDQMI*QYEEQSANYVS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 5 .66 RPM |
| SRP051959_heart | 0 .02 RPM | 8 .54 RPM |
| SRP051959_kidney | 0 .00 RPM | 6 .81 RPM |
| SRP051959_liver | 0 .00 RPM | 3 .86 RPM |
| SRP051959_lung | 0 .00 RPM | 10 .95 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 9 .41 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 7 .71 RPM |
| SRP051959_spleen | 0 .00 RPM | 10 .27 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000003082 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000012160 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000000769 | 1 retrocopy |
retro_cjac_2231 ,
|
| Callithrix jacchus | ENSCJAG00000002309 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000000549 | 1 retrocopy | |
| Homo sapiens | ENSG00000135334 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002448 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002824 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016831 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000018409 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000008288 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000006084 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000011555 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000004307 | 1 retrocopy |