RetrogeneDB ID: | retro_ggor_2071 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 4:160004808..160005117(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | AKIRIN2 | ||
| Ensembl ID: | ENSGGOG00000002448 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 85.05 % |
| Parental protein coverage: | 51.72 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 2 |
| Parental | ETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYE |
| ETSFQ.TDPCCTSDA..HAFLLSG.ASPGTSSAASSPLKKEQPLFTL.QVGMICE..LKE.EEKV.EEYE | |
| Retrocopy | ETSFQDTDPCCTSDA--HAFLLSGSASPGTSSAASSPLKKEQPLFTLWQVGMICEH*LKEHEEKVWEEYE |
| Parental | E-ILNTKLAEQ-YDAFVKFTHDQIMRRYGEQPASYVS |
| E.ILNTKLAEQ..DA.VKFTHDQIM.RYGE.P.SYVS | |
| Retrocopy | E<ILNTKLAEQ>NDASVKFTHDQIM*RYGEEPSSYVS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 24 .22 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 21 .31 RPM |
| SRP007412_heart | 0 .00 RPM | 5 .88 RPM |
| SRP007412_kidney | 0 .00 RPM | 15 .62 RPM |
| SRP007412_liver | 0 .00 RPM | 13 .06 RPM |
| SRP007412_testis | 0 .00 RPM | 44 .44 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2991 |
| Pan troglodytes | retro_ptro_2023 |
| Pongo abelii | retro_pabe_2477 |
| Macaca mulatta | retro_mmul_1914 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000003082 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000012160 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000000769 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000000549 | 1 retrocopy | |
| Homo sapiens | ENSG00000135334 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002448 | 1 retrocopy |
retro_ggor_2071 ,
|
| Gorilla gorilla | ENSGGOG00000006053 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002824 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016831 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000018409 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000008288 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000006084 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000011555 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000004307 | 1 retrocopy |