RetrogeneDB ID: | retro_sscr_858 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 6:16833370..16833632(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TCEB2 | ||
| Ensembl ID: | ENSSSCG00000008061 | ||
| Aliases: | None | ||
| Description: | transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) [Source:HGNC Symbol;Acc:11619] |
| Percent Identity: | 51.11 % |
| Parental protein coverage: | 71.19 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 3 |
| Parental | TIFTDAKESSTVFELKRIVE-GILKRPPDE-QRLYKDDQLLDDGKTLGECGFTSQT-ARPQAPATVGLAF |
| TIF.DAKESSTV...KR.V..GIL..PP.....LYKDDQLLD...TL.ECG.T..T......P.T..L.. | |
| Retrocopy | TIFRDAKESSTVLGMKRLVK>GILRWPPAQ>EQLYKDDQLLDKSMTLEECGYTRWT<TPVHPPFTLDLGL |
| Parental | RADEA---FEALRIEPFSSP |
| .AD.A...F..L...PF..P | |
| Retrocopy | PADRAHLAFDTLSLKPFFNP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 104 .06 RPM |
| SRP014902_testis | 0 .00 RPM | 144 .42 RPM |
| SRP018288_heart | 0 .00 RPM | 53 .12 RPM |
| SRP018288_kidney | 0 .00 RPM | 81 .07 RPM |
| SRP018288_liver | 0 .00 RPM | 55 .49 RPM |
| SRP018288_lung | 0 .00 RPM | 73 .11 RPM |
| SRP018856_adipose | 0 .00 RPM | 78 .89 RPM |
| SRP035408_brain | 0 .00 RPM | 99 .98 RPM |
| SRP035408_liver | 0 .00 RPM | 74 .80 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019543 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015347 | 10 retrocopies | |
| Cavia porcellus | ENSCPOG00000021024 | 1 retrocopy | |
| Felis catus | ENSFCAG00000004711 | 2 retrocopies | |
| Homo sapiens | ENSG00000103363 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015306 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000016536 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000055839 | 7 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000009471 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000010116 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007013 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007663 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000004814 | 6 retrocopies | |
| Sus scrofa | ENSSSCG00000008061 | 1 retrocopy |
retro_sscr_858 ,
|