RetrogeneDB ID: | retro_cjac_1606 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 17:62949552..62949901(-) | ||
| Located in intron of: | ENSCJAG00000011776 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TCEB2 | ||
| Ensembl ID: | ENSCJAG00000015347 | ||
| Aliases: | None | ||
| Description: | transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) [Source:HGNC Symbol;Acc:11619] |
| Percent Identity: | 72.27 % |
| Parental protein coverage: | 99.15 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | DVFLMIRRHKTTIFTDAKE-SSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFT-SQTARP |
| D.FL.IRR..TT.F.DAK..SS.V.E.K...EGIL.RPPD.QRL..DDQLLDDGKTLGECG.T..QTARP | |
| Retrocopy | DAFLRIRRPETTTFKDAKG<SSAVCEPKHMFEGILNRPPDKQRLHEDDQLLDDGKTLGECGLT<HQTARP |
| Parental | QAPATVGLAFRAEDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ |
| QAPATVGLAFRA.D..E.L.I.PFSSPPELPD..K..DSGSSA.E.AVQ | |
| Retrocopy | QAPATVGLAFRADDAIEVLPIKPFSSPPELPDARKSRDSGSSASERAVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .07 RPM | 10 .29 RPM |
| SRP051959_heart | 0 .12 RPM | 12 .87 RPM |
| SRP051959_kidney | 0 .09 RPM | 13 .42 RPM |
| SRP051959_liver | 0 .48 RPM | 16 .83 RPM |
| SRP051959_lung | 0 .26 RPM | 8 .82 RPM |
| SRP051959_lymph_node | 0 .11 RPM | 7 .35 RPM |
| SRP051959_skeletal_muscle | 0 .04 RPM | 24 .09 RPM |
| SRP051959_spleen | 0 .00 RPM | 7 .67 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019543 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015347 | 10 retrocopies |
retro_cjac_1593, retro_cjac_1606 , retro_cjac_2051, retro_cjac_2613, retro_cjac_2987, retro_cjac_3030, retro_cjac_342, retro_cjac_3819, retro_cjac_639, retro_cjac_959,
|
| Cavia porcellus | ENSCPOG00000021024 | 1 retrocopy | |
| Felis catus | ENSFCAG00000004711 | 2 retrocopies | |
| Homo sapiens | ENSG00000103363 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015306 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000016536 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000015265 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000055839 | 7 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000009471 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000010116 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007013 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007663 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000004814 | 6 retrocopies | |
| Sus scrofa | ENSSSCG00000008061 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015454 | 5 retrocopies |