RetrogeneDB ID: | retro_sscr_829 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 5:104152674..104153118(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MYL6 | ||
| Ensembl ID: | ENSSSCG00000025467 | ||
| Aliases: | None | ||
| Description: | Sus scrofa myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), mRNA. [Source:RefSeq mRNA;Acc:NM_001163997] |
| Percent Identity: | 60.14 % |
| Parental protein coverage: | 98.01 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLP |
| .F..DQ..E.K.AFQL.D..GDGK.LYSQC.D..RALGQN..NA..LKVL.N.KSDE......DFE.FLP | |
| Retrocopy | EFNKDQLEELKDAFQLLD*VGDGKTLYSQCADMVRALGQNLSNAKMLKVLVNLKSDELKSQHMDFEIFLP |
| Parental | MLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYE |
| .LQ...KN.D.GTY.DY.EGL.VFDKE.N...MGAE.R..L.T.GEK..E.E.....AGHEDS..CI.YE | |
| Retrocopy | ILQAATKNLDKGTYQDYLEGLLVFDKERNSKAMGAELRRILTTTGEKIPEQEAVAGLAGHEDSKDCIIYE |
| Parental | AFVRHILS |
| .F..HILS | |
| Retrocopy | DFWKHILS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 137 .91 RPM |
| SRP014902_testis | 0 .14 RPM | 41 .44 RPM |
| SRP018288_heart | 0 .00 RPM | 12 .73 RPM |
| SRP018288_kidney | 0 .00 RPM | 21 .57 RPM |
| SRP018288_liver | 0 .00 RPM | 5 .60 RPM |
| SRP018288_lung | 0 .00 RPM | 38 .18 RPM |
| SRP018856_adipose | 0 .00 RPM | 130 .68 RPM |
| SRP035408_brain | 0 .00 RPM | 13 .94 RPM |
| SRP035408_liver | 0 .00 RPM | 5 .90 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Homo sapiens | ENSG00000092841 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000001272 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000031838 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000090841 | 7 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000205 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000017371 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000034596 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004647 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000005080 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000004472 | 6 retrocopies | |
| Sus scrofa | ENSSSCG00000025467 | 1 retrocopy |
retro_sscr_829 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000023318 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000000485 | 8 retrocopies |