RetrogeneDB ID: | retro_mmus_1504 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 16:24369787..24370232(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Myl6 | ||
| Ensembl ID: | ENSMUSG00000090841 | ||
| Aliases: | Myl6, ESMLC, LC17, LC17-GI, LC17-NM, LC17A, LC17B, MLC-3, MLC1SM, MLC3SM, MLC3nm, Myln | ||
| Description: | myosin, light polypeptide 6, alkali, smooth muscle and non-muscle [Source:MGI Symbol;Acc:MGI:109318] |
| Percent Identity: | 68.18 % |
| Parental protein coverage: | 98.68 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 5 |
| Parental | DFTEDQTAEFKEAFQLFDRTG-DGKILYSQCGDVMRALGQNPTNAEVLKVLG-NPKSDEMNVKVLDFEHF |
| DF..DQ..E.KEA.QLF.RT..DGKIL..QC.D.M.ALGQNP.NAEVLKV.G..PKSDEM.V.VLDFEHF | |
| Retrocopy | DFPGDQATELKEAYQLFNRTK<DGKILCTQCEDMMKALGQNPPNAEVLKVRG<SPKSDEMDVNVLDFEHF |
| Parental | LPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGT-VMGAEIRHVLVTLGEKMTEEEVEMLVA-GHEDSNGC |
| L..LQTVAKNKDQGT.EDYV..L.VF.KE..GT.V.G.EI.HVLV.LGEKM.EE.VEML...G.....G. | |
| Retrocopy | LSVLQTVAKNKDQGTHEDYVGSLLVFGKEKYGT>VTGSEIHHVLVMLGEKMMEEKVEMLGT>GEDSNGG- |
| Parental | INYEEL-VRMVLNG |
| INY.EL.V..VLNG | |
| Retrocopy | INYGEL>VQVVLNG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 86 .35 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 88 .75 RPM |
| SRP007412_heart | 0 .03 RPM | 73 .25 RPM |
| SRP007412_kidney | 0 .02 RPM | 113 .42 RPM |
| SRP007412_liver | 0 .00 RPM | 60 .32 RPM |
| SRP007412_testis | 0 .09 RPM | 23 .83 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Macropus eugenii | ENSMEUG00000001272 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000031838 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000061816 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000090841 | 7 retrocopies |
retro_mmus_1281, retro_mmus_1504 , retro_mmus_2328, retro_mmus_3231, retro_mmus_3333, retro_mmus_3358, retro_mmus_434,
|
| Nomascus leucogenys | ENSNLEG00000000205 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000017371 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000034596 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004647 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000004472 | 6 retrocopies | |
| Sus scrofa | ENSSSCG00000025467 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000023318 | 1 retrocopy |