RetrogeneDB ID: | retro_rnor_2811 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | X:66294901..66295117(+) | ||
| Located in intron of: | ENSRNOG00000021694 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Atg12 | ||
| Ensembl ID: | ENSRNOG00000000157 | ||
| Aliases: | Atg12, Apg12l | ||
| Description: | Ubiquitin-like protein ATG12 [Source:UniProtKB/Swiss-Prot;Acc:Q2TBJ5] |
| Percent Identity: | 88.16 % |
| Parental protein coverage: | 53.9 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | TPIMKTKKWAVERTRTVQALIDFIRKFLRLLASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYC |
| .PIMKTKKWAVER.RT.QALIDFIRKFLRLL.SEQLFIYV....APSPDQEVGTLYEC.GSDGKLVLHYC | |
| Retrocopy | SPIMKTKKWAVERPRTIQALIDFIRKFLRLLVSEQLFIYV----APSPDQEVGTLYECSGSDGKLVLHYC |
| Parental | KSQAWG |
| KSQAWG | |
| Retrocopy | KSQAWG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 56 .94 RPM |
| SRP017611_kidney | 0 .00 RPM | 43 .06 RPM |
| SRP017611_liver | 0 .00 RPM | 22 .39 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004464 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000007187 | 2 retrocopies | |
| Equus caballus | ENSECAG00000012452 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000018837 | 1 retrocopy | |
| Homo sapiens | ENSG00000145782 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016888 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000015307 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000002759 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015699 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000017154 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000000157 | 1 retrocopy |
retro_rnor_2811 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000011755 | 1 retrocopy |