RetrogeneDB ID: | retro_rnor_1547 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 2:162604568..162604945(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSRNOG00000038186 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RGD1305713 | ||
| Ensembl ID: | ENSRNOG00000019514 | ||
| Aliases: | None | ||
| Description: | UPF0235 protein C15orf40 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q505I4] |
| Percent Identity: | 91.34 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MPKKAGATSKGKNQTKEPETPPPPTGPVATDSKGFVTIAIHAKPGSKQNAVTDLNTEAVGVA-IAAPPSE |
| MPKKA.ATSK.KNQTKEPETPPPPTGP.ATDSKGFVTIAIHAKP.SKQN.VTDLNTEAVGVA.IAAPPS. | |
| Retrocopy | MPKKAAATSKRKNQTKEPETPPPPTGPAATDSKGFVTIAIHAKPSSKQNVVTDLNTEAVGVA<IAAPPSQ |
| Parental | GEANAELCRYLSKVLDLRKSDVVLDKGGKSREKVVKLLASTTPEEVLEKLRTEAEKK |
| GEANAELC.YLSKVLDLRKSDV.LDKGGKSREKVVKLLASTTPEEVLEKLRTE.EK. | |
| Retrocopy | GEANAELCWYLSKVLDLRKSDVALDKGGKSREKVVKLLASTTPEEVLEKLRTETEKQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 6 .04 RPM |
| SRP017611_kidney | 0 .00 RPM | 2 .93 RPM |
| SRP017611_liver | 0 .00 RPM | 2 .42 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016522 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000013185 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015877 | 2 retrocopies | |
| Equus caballus | ENSECAG00000022459 | 1 retrocopy | |
| Homo sapiens | ENSG00000169609 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000023062 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000009564 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000007515 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015890 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019374 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000010930 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000005072 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000016446 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006737 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019514 | 2 retrocopies |
retro_rnor_1547 , retro_rnor_2334,
|
| Sorex araneus | ENSSARG00000006314 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000017947 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000030131 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014387 | 6 retrocopies |