RetrogeneDB ID: | retro_ptro_966 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 14:43775985..43776183(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSPTRG00000038961 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DDA1 | ||
| Ensembl ID: | ENSPTRG00000010668 | ||
| Aliases: | None | ||
| Description: | DET1 and DDB1 associated 1 [Source:UniProtKB/TrEMBL;Acc:K7CQT7] |
| Percent Identity: | 93.94 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKK |
| MADFLKGLPVYNKSNFSRFH.DSVCKASN.RPSVYLPTREYPSEQIIVTEKTNILLRYLHQQW.K. | |
| Retrocopy | MADFLKGLPVYNKSNFSRFHGDSVCKASNQRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWTKR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 1 .04 RPM | 7 .67 RPM |
| SRP007412_cerebellum | 0 .90 RPM | 7 .96 RPM |
| SRP007412_heart | 0 .96 RPM | 6 .38 RPM |
| SRP007412_kidney | 1 .02 RPM | 5 .41 RPM |
| SRP007412_liver | 1 .31 RPM | 10 .41 RPM |
| SRP007412_testis | 3 .58 RPM | 18 .65 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1409 |
| Gorilla gorilla | retro_ggor_1093 |
| Pongo abelii | retro_pabe_1167 |
| Macaca mulatta | retro_mmul_2248 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000017068 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000031251 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000006944 | 1 retrocopy | |
| Felis catus | ENSFCAG00000001001 | 1 retrocopy | |
| Homo sapiens | ENSG00000130311 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000005802 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000001763 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003990 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016231 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005738 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003701 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009710 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010668 | 1 retrocopy |
retro_ptro_966 ,
|
| Rattus norvegicus | ENSRNOG00000039417 | 1 retrocopy |