RetrogeneDB ID: | retro_cpor_435 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_15:31027999..31028295(-) | ||
| Located in intron of: | ENSCPOG00000013559 | ||
Retrocopyinformation | Ensembl ID: | ENSCPOG00000021433 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DDA1 | ||
| Ensembl ID: | ENSCPOG00000006944 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.28 % |
| Parental protein coverage: | 98.04 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | DFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKK- |
| .FLKGLPVY.K..FS.FHA.SV.KA.N..P.VYLP..EY..EQIIVTEKTNILL.YLHQQWD.KNAAK.. | |
| Retrocopy | NFLKGLPVYSKGSFSGFHATSVYKAPNQCPCVYLPIWEYLPEQIIVTEKTNILLCYLHQQWD-KNAAKR< |
| Parental | RDQEQVELEGESSAPPRKVARTDSPDMHEDT |
| RDQEQVELEGESS.P.......DSP.MHEDT | |
| Retrocopy | RDQEQVELEGESSMPCLMILQLDSPNMHEDT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 17 .14 RPM |
| SRP017611_kidney | 0 .00 RPM | 10 .15 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .57 RPM |
| SRP040447_lung | 0 .00 RPM | 20 .88 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 9 .52 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000017068 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000031251 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000006944 | 1 retrocopy |
retro_cpor_435 ,
|
| Felis catus | ENSFCAG00000001001 | 1 retrocopy | |
| Homo sapiens | ENSG00000130311 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000005802 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000001763 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003990 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016231 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005738 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003701 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009710 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010668 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000039417 | 1 retrocopy |