RetrogeneDB ID: | retro_cfam_2033 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | JH373336.1:48038..48239(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DDA1 | ||
| Ensembl ID: | ENSCAFG00000031251 | ||
| Aliases: | None | ||
| Description: | DET1 and DDB1 associated 1 [Source:HGNC Symbol;Acc:28360] |
| Percent Identity: | 76.12 % |
| Parental protein coverage: | 66.34 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | SVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKKRDQEQVDLEGESSAPPRK |
| ..CKA.NR.PSVYLPTREYPSEQII.T.KTNILL..LH.QWDKKN.AKKRDQE..D.EGESSA.P.. | |
| Retrocopy | TLCKALNRCPSVYLPTREYPSEQIIGTAKTNILLGHLH*QWDKKNVAKKRDQEHMDFEGESSALPHR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .08 RPM | 17 .22 RPM |
| SRP017611_brain | 0 .08 RPM | 15 .01 RPM |
| SRP017611_kidney | 0 .00 RPM | 8 .39 RPM |
| SRP017611_liver | 0 .15 RPM | 5 .95 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000017068 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000031251 | 3 retrocopies |
retro_cfam_1089, retro_cfam_2033 , retro_cfam_475,
|
| Cavia porcellus | ENSCPOG00000006944 | 1 retrocopy | |
| Felis catus | ENSFCAG00000001001 | 1 retrocopy | |
| Homo sapiens | ENSG00000130311 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000005802 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000001763 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003990 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016231 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005738 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003701 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009710 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010668 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000039417 | 1 retrocopy |