RetrogeneDB ID: | retro_ptro_2893 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 9:41589584..41589918(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RAB28 | ||
| Ensembl ID: | ENSPTRG00000015920 | ||
| Aliases: | None | ||
| Description: | RAB28, member RAS oncogene family [Source:UniProtKB/TrEMBL;Acc:K7BAC3] |
| Percent Identity: | 66.38 % |
| Parental protein coverage: | 58.16 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | DWYTVVKKVSEESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSV-FLCFQKVA |
| D.Y.V.KK.SEESE...LVALV.NKI.LEHM.T.KPEKHL.FCQENGFSSHF.SAKTGD......F.K.. | |
| Retrocopy | DGYIVLKKGSEESEALLLVALVSNKIYLEHMETVKPEKHLWFCQENGFSSHFISAKTGDCL<SCIFRKLL |
| Parental | AEIL-GIKLNKAEIEQSQRVVKADIVNYNQEPMSRTVNPPRSSMCA |
| ...L.G.KLNKAE...SQRVVKA.I.NYNQ.P..RTV..P.SSM.A | |
| Retrocopy | MKSL<GLKLNKAEK*KSQRVVKAGIGNYNQAP--RTVTLPTSSMSA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 14 .32 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 14 .84 RPM |
| SRP007412_heart | 0 .00 RPM | 11 .48 RPM |
| SRP007412_kidney | 0 .00 RPM | 12 .97 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .37 RPM |
| SRP007412_testis | 0 .00 RPM | 62 .39 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000001523 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000012136 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007750 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000012378 | 1 retrocopy | |
| Homo sapiens | ENSG00000157869 | 7 retrocopies | |
| Gorilla gorilla | ENSGGOG00000024190 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006792 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000022025 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016243 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014610 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015920 | 2 retrocopies |
retro_ptro_2893 , retro_ptro_3171,
|
| Rattus norvegicus | ENSRNOG00000017074 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000009274 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000022358 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000004135 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000010939 | 2 retrocopies |