RetrogeneDB ID: | retro_ptro_180 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 1:106272444..106272896(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CDK4 | ||
| Ensembl ID: | ENSPTRG00000005147 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 76.47 % |
| Parental protein coverage: | 50.17 % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected | 1 |
| Parental | AETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADF-GLARIYSYQMALTPVVVTLWYRA |
| AE..KDLM..F.RGLDFLHA.CIVH..L.PENILVTSGGTVKLAD..GLA.IYSYQMALTPVVVTL.Y.A | |
| Retrocopy | AEAFKDLMHKFRRGLDFLHAHCIVH*YLRPENILVTSGGTVKLADL<GLASIYSYQMALTPVVVTLFYCA |
| Parental | PEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPR |
| .EVL.QST.AT.VDM..VGC.FAEMF..KPLFCG.S.A..LGKIF.LIGLP..DDWP.DVSLP.GAF..R | |
| Retrocopy | HEVL-QSTQATSVDM*RVGCVFAEMFPQKPLFCGSSKAN*LGKIFNLIGLPL*DDWP*DVSLPHGAFLHR |
| Parental | GPRPVQSVVPEME |
| GP.PVQSVVPE.E | |
| Retrocopy | GPHPVQSVVPERE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 18 .04 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 20 .58 RPM |
| SRP007412_heart | 0 .00 RPM | 20 .43 RPM |
| SRP007412_kidney | 0 .00 RPM | 48 .35 RPM |
| SRP007412_liver | 0 .00 RPM | 28 .09 RPM |
| SRP007412_testis | 0 .00 RPM | 18 .55 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_275 |
| Macaca mulatta | retro_mmul_401 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000007160 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000000280 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000006697 | 3 retrocopies | |
| Felis catus | ENSFCAG00000029663 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001404 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014609 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000003789 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000023651 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000023694 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000006728 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000017205 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005147 | 1 retrocopy |
retro_ptro_180 ,
|
| Pan troglodytes | ENSPTRG00000019872 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000011937 | 3 retrocopies |