RetrogeneDB ID: | retro_ptro_1073 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 15:72874775..72875180(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ANP32B | ||
| Ensembl ID: | ENSPTRG00000021172 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 95.56 % |
| Parental protein coverage: | 53.78 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLE |
| MDMKRRIHLELRN.TP.AVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLE | |
| Retrocopy | MDMKRRIHLELRNWTPSAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLE |
| Parental | LSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDLFNCEVTNLNDYRESV |
| LSENRIFGGLDMLAEKLPNLT..NLSGNKLKDISTLEPLKKLECLKSLDLFNCEVTN.NDYRE.V | |
| Retrocopy | LSENRIFGGLDMLAEKLPNLTRPNLSGNKLKDISTLEPLKKLECLKSLDLFNCEVTNMNDYRERV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 36 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 40 .58 RPM |
| SRP007412_heart | 0 .00 RPM | 54 .12 RPM |
| SRP007412_kidney | 0 .05 RPM | 55 .89 RPM |
| SRP007412_liver | 0 .00 RPM | 94 .86 RPM |
| SRP007412_testis | 0 .00 RPM | 78 .30 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1597 |
| Pongo abelii | retro_pabe_1312 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000005149 | 6 retrocopies | |
| Cavia porcellus | ENSCPOG00000020118 | 3 retrocopies | |
| Equus caballus | ENSECAG00000012310 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000015514 | 4 retrocopies | |
| Homo sapiens | ENSG00000136938 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000004844 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000012242 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000003261 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000006433 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028333 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016941 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000006091 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000007219 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000021172 | 3 retrocopies |
retro_ptro_1073 , retro_ptro_1075, retro_ptro_40,
|
| Pteropus vampyrus | ENSPVAG00000006569 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000000804 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002189 | 8 retrocopies | |
| Tursiops truncatus | ENSTTRG00000010825 | 2 retrocopies |