RetrogeneDB ID: | retro_cpor_509 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_176:318455..318752(+) | ||
| Located in intron of: | ENSCPOG00000003259 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ANP32B | ||
| Ensembl ID: | ENSCPOG00000020118 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 63.64 % |
| Parental protein coverage: | 57.4 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | EGLTAEFVNL-EFLSLINVCLLSVSNLPKLPKLKKLELSDNRIFGGLDMLAEKLPNLTHLN-LSGNKLKD |
| .G.T.....L.EFLSLIN.CL...SN.PKL.KLK.LEL.D...F..LD.L.EKL.NLTH.N.LSGNKLK. | |
| Retrocopy | QGFTTGICELQEFLSLINICLILASNFPKLFKLKRLELCDSKLF*SLDSLTEKLLNLTHINFLSGNKLKN |
| Parental | ISTLEPLKKLDCLKSLDLFNCEVTNLNDY |
| .S.L..LKKLDCLKSLDL.N.EV.NL..Y | |
| Retrocopy | NSILKSLKKLDCLKSLDLSNWEVANLRTY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .06 RPM | 18 .52 RPM |
| SRP017611_kidney | 0 .10 RPM | 40 .51 RPM |
| SRP017611_liver | 0 .00 RPM | 22 .81 RPM |
| SRP040447_lung | 0 .03 RPM | 37 .48 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 20 .37 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000005149 | 6 retrocopies | |
| Cavia porcellus | ENSCPOG00000020118 | 3 retrocopies |
retro_cpor_1336, retro_cpor_493, retro_cpor_509 ,
|
| Equus caballus | ENSECAG00000012310 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000015514 | 4 retrocopies | |
| Homo sapiens | ENSG00000136938 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000004844 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000012242 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000003261 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000006433 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028333 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016941 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000006091 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000019430 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000021172 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000006569 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000000804 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002189 | 8 retrocopies | |
| Tursiops truncatus | ENSTTRG00000010825 | 2 retrocopies |