RetrogeneDB ID: | retro_pabe_2388 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 3:177961462..177961777(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ANAPC15 | ||
| Ensembl ID: | ENSPPYG00000003646 | ||
| Aliases: | None | ||
| Description: | anaphase promoting complex subunit 15 [Source:HGNC Symbol;Acc:24531] |
| Percent Identity: | 56.14 % |
| Parental protein coverage: | 92.56 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 2 |
| Parental | PRVTETLWF-NLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEE |
| P.VT..L.F.NL...CVEETELQQQEQQHQA...S..EKDNNL.P...P.S.HY.D...E..E....... | |
| Retrocopy | PEVTDIL*F>NLY*TCVEETELQQQEQQHQAC--SFTEKDNNLFP--EPGSKHYED---EGEEYEDEEDS |
| Parental | DS-EDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI |
| .....DE.MQDMD.MND.NE.P.DG..N.VD..GN.QDQD.W.I | |
| Retrocopy | KE<MEDEHMQDMDDMNDFNE*PGDGDTNDVDVGGNKQDQDKWTI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .05 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .97 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .96 RPM |
| SRP007412_kidney | 0 .00 RPM | 2 .12 RPM |
| SRP007412_liver | 0 .03 RPM | 0 .52 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_1999 |
| Bos taurus | retro_btau_269 |
| Equus caballus | retro_ecab_470 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010843 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000002999 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000005781 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021041 | 1 retrocopy | |
| Felis catus | ENSFCAG00000005321 | 1 retrocopy | |
| Homo sapiens | ENSG00000110200 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000014120 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016270 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000010260 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017234 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003646 | 2 retrocopies |
retro_pabe_2388 , retro_pabe_3720,
|
| Pteropus vampyrus | ENSPVAG00000015797 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000004171 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000014179 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010773 | 1 retrocopy |